DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and CG6462

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:359 Identity:99/359 - (27%)
Similarity:152/359 - (42%) Gaps:83/359 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1027 YSAVNATSVLTQLTHRPLLATVNVSTDIWKMYAKRKSTLMQEFANCK-KTED------------- 1077
            |.|.:|..:|.      |.:|:..|::.|          :..|.:.| :|.|             
  Fly     4 YQATSAFFLLL------LSSTLVKSSEPW----------LDTFEHPKEETPDDDDAIMERRWQLG 52

  Fly  1078 YPMADLTCSNYECGRVKRGRHKPS--RRIIGGTQASPGNWPF---LAAILGGPEKIFYCAGVLIS 1137
            |....|.|..:|    ..|....:  .||.||..|:.|.:|:   |...|.|.: :..|.|.||:
  Fly    53 YENFRLRCEKFE----MEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGAD-LVKCGGSLIT 112

  Fly  1138 DQWVLTASHCV----------GNYSVIDLEDWTIQLGVTRRNSFTYSGQKVKVKAVIPHPQYNMA 1192
            .|:||||:||:          |.....|:||...:|.||.|:...|             |.| :.
  Fly   113 LQFVLTAAHCLTDAIAAKIYTGATVFADVEDSVEELQVTHRDFIIY-------------PDY-LG 163

  Fly  1193 IAHDNDIALFQLATRVAFHEHLLPVCLPPPSV-RNLHPGTLCTVIGWGKREDKDPKST--YEYIV 1254
            ....:|:||.:|..:|...|.:.|:.|....: :|...|.:.|:.|||...|...|.|  .:|:.
  Fly   164 FGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLD 228

  Fly  1255 NEVQVPIITRNQC-DEWLDNLTVSEGMVCAGFDDG--GKDACQGDSGGPLLCPYPGEKNRWFVGG 1316
            .||    |.:.:| ..:|..|......:|.   ||  |:.||.||||||::..:   :|..::.|
  Fly   229 AEV----IDQERCICYFLPGLVSQRRHLCT---DGSNGRGACNGDSGGPVVYHW---RNVSYLIG 283

  Fly  1317 IVSWGIM--CAHPRLPGVYANVVQYVPWIQEQIA 1348
            :.|:|..  | ....|.||..:..|:|||::|.|
  Fly   284 VTSFGSAEGC-EVGGPTVYTRITAYLPWIRQQTA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555 3/6 (50%)
SRCR 992..1086 CDD:278931 14/72 (19%)
Tryp_SPc 1103..1343 CDD:214473 78/260 (30%)
Tryp_SPc 1104..1346 CDD:238113 79/262 (30%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 78/260 (30%)
Tryp_SPc 77..314 CDD:238113 79/262 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.