DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and Fzd8

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001037716.1 Gene:Fzd8 / 364754 RGDID:1560525 Length:684 Species:Rattus norvegicus


Alignment Length:132 Identity:37/132 - (28%)
Similarity:63/132 - (47%) Gaps:5/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 CLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKCG 843
            |..|.|..|:|  |.||||..||...|..|.|...::..:..||:::|...:..|||:::.|.|.
  Rat    35 CQEITVPLCKG--IGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICL 97

  Fly   844 QS-GATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVR-EVMRAAT 906
            :. ...:|||:::|......|......:|.:.|:.:.|....: ..:.|.:.:|..| ::..||.
  Rat    98 EDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPE-QGNPDTLCMDYNRTDLTTAAP 161

  Fly   907 HP 908
            .|
  Rat   162 SP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 32/115 (28%)
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Fzd8NP_001037716.1 CRD_FZ8 31..155 CDD:143570 34/122 (28%)
Palmitate-binding groove. /evidence=ECO:0000250 71..78 2/6 (33%)
Wnt-binding. /evidence=ECO:0000250 95..100 1/4 (25%)
Wnt-binding. /evidence=ECO:0000250 147..152 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..222 3/9 (33%)
PHA03356 <183..219 CDD:177594
Frizzled 264..614 CDD:279827
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 605..610
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 630..655
PDZ-binding. /evidence=ECO:0000250 682..684
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.