DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and PRSS41

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:275 Identity:93/275 - (33%)
Similarity:143/275 - (52%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1090 CGRVKRGRHKPSRRII-GGTQASPGNWPFLAAILGGPEKIFYCAGVLISDQWVLTASHCVGNYSV 1153
            ||      |:....:: ||.:::.|.||:.|::  ...:...|.|.|:|.:|||:|:||...:..
Human    62 CG------HREIHALVAGGVESARGRWPWQASL--RLRRRHRCGGSLLSRRWVLSAAHCFQKHYY 118

  Fly  1154 IDLEDWTIQLG-VTRR----NSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQLATRVAFHEH 1213
              ..:||:||| :|.|    |...|| .:.||:.:|.:|.....:.  |||||.:||:.|.::.:
Human   119 --PSEWTVQLGELTSRPTPWNLRAYS-SRYKVQDIIVNPDALGVLR--NDIALLRLASSVTYNAY 178

  Fly  1214 LLPVCLPPPSVRNLH-PGTLCTVIGWGKREDKDPKSTYEYIVNEVQVPIITRNQCDEWLDNLT-- 1275
            :.|:|:...:...:| |.  |.|.|||............|.:.|.||.|:...:|:...:..:  
Human   179 IQPICIESSTFNFVHRPD--CWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSR 241

  Fly  1276 --VSEGMVCAGFDDGGKDACQGDSGGPLLCPYPGEKNRWFVGGIVSWGIMCAHPRLPGVYANVVQ 1338
              :.:.|.|||.:||..|.|:|||||||:|...|   .|:..||||||:.|..|..||||.|:..
Human   242 SMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDG---LWYQVGIVSWGMDCGQPNRPGVYTNISV 303

  Fly  1339 YVPWIQEQIAKHSRP 1353
            |..||: ::..||.|
Human   304 YFHWIR-RVMSHSTP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473 85/250 (34%)
Tryp_SPc 1104..1346 CDD:238113 87/252 (35%)
PRSS41NP_001382429.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.