DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and fz4

DIOPT Version :10

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster


Alignment Length:112 Identity:35/112 - (31%)
Similarity:52/112 - (46%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   774 PAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLF 838
            ||...|..|.:..|:  :|.||.|..||.:|:..|.:.:..|.::..|::..|...:.||||..:
  Fly    41 PAFRQCETIRIEMCR--KIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAY 103

  Fly   839 VPKCGQSGA--TVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLF 883
            ||.|.....  .:.||::||.....||......||...|..|:|..|
  Fly   104 VPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 33/108 (31%)
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
Tryp_SPc 1104..1346 CDD:238113
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 33/110 (30%)
7tmF_Frizzled_SMO 222..557 CDD:320089
TM helix 1 231..256 CDD:320089
TM helix 2 268..289 CDD:320089
TM helix 3 321..347 CDD:320089
TM helix 4 388..404 CDD:320089
TM helix 5 426..455 CDD:320089
TM helix 6 481..508 CDD:320089
TM helix 7 519..544 CDD:320089
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.