DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and CG6048

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:274 Identity:91/274 - (33%)
Similarity:135/274 - (49%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1103 RIIGGTQASPGNWPFLAAILGGPEKIFY------CAGVLISDQWVLTASHCVGNYSVID-----L 1156
            |||.||:||.|.......|.......::      |.|.||...|||||:||..:..:.|     .
  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109

  Fly  1157 EDWTIQLG----VTRRNSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQL-ATRVAFHEHLLP 1216
            |::.:.:|    ..|.|:.|::.:    :.::...::::: .:|.||||..| .|....|..:.|
  Fly   110 EEFIVVMGNLDRYNRTNTLTFTIE----ERIMQLDKFDLS-TYDKDIALLMLNGTVPTGHPTIRP 169

  Fly  1217 VCLPPPSVRNLHPGTLCTVIGWGKREDKDPKSTYEYIVNEVQVPIITRNQC--DEWLDNLTVSEG 1279
            :.|...::..   |.:|.|.|||..||    .....|:..|.||:|:...|  |..|.:| :..|
  Fly   170 IALNRFAIPE---GVVCQVTGWGNTED----GYVSDILMTVDVPMISEEHCINDSDLGHL-IQPG 226

  Fly  1280 MVCAGF-DDGGKDACQGDSGGPLLCPYPGEKNRWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWI 1343
            |:|||: :.|.||||.|||||||:|...       :.|:|||||.||.|||||||..|..|..||
  Fly   227 MICAGYLEVGEKDACAGDSGGPLVCQSE-------LAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284

  Fly  1344 QEQIAKHSRPIKED 1357
            .:.:.::.....|:
  Fly   285 LQNMGENGEGSGEE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473 88/258 (34%)
Tryp_SPc 1104..1346 CDD:238113 89/260 (34%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 88/258 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.