| Sequence 1: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001101336.1 | Gene: | Loxl3 / 312478 | RGDID: | 1311011 | Length: | 754 | Species: | Rattus norvegicus |
| Alignment Length: | 239 | Identity: | 49/239 - (20%) |
|---|---|---|---|
| Similarity: | 81/239 - (33%) | Gaps: | 91/239 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 957 CIGTK-HI---------------CDG----IIDCPYG-----------------QDERNCLRLSE 984
Fly 985 RNGDVGTGVLEVYRIGQRQWMPACVKNWDRAVSPSAVCSILGYSAVNATSVLTQLTHRPLLATVN 1049
Fly 1050 VS--------TDIWKMYAKRKSTLMQEFANCKKTEDYPMADLTCSNYECG-----RVKRGRHKPS 1101
Fly 1102 RRI---IGGTQASPGN--WPFLAAILGGPEKIFYCAGVLISDQW 1140 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | |
| LDLa | 911..942 | CDD:238060 | |||
| LDLa | 945..979 | CDD:238060 | 10/58 (17%) | ||
| SR | 980..>1034 | CDD:214555 | 17/53 (32%) | ||
| SRCR | 992..1086 | CDD:278931 | 22/101 (22%) | ||
| Tryp_SPc | 1103..1343 | CDD:214473 | 9/43 (21%) | ||
| Tryp_SPc | 1104..1346 | CDD:238113 | 8/42 (19%) | ||
| Loxl3 | NP_001101336.1 | SR | 46..145 | CDD:214555 | |
| SRCR | 54..146 | CDD:278931 | |||
| SR | 170..282 | CDD:214555 | 6/32 (19%) | ||
| SRCR | 187..282 | CDD:278931 | 6/32 (19%) | ||
| SR | 308..408 | CDD:214555 | 25/113 (22%) | ||
| SRCR | 313..408 | CDD:278931 | 23/107 (21%) | ||
| SR | 418..526 | CDD:214555 | 12/55 (22%) | ||
| SRCR | 423..526 | CDD:278931 | 11/50 (22%) | ||
| Lysyl_oxidase | 531..725 | CDD:279521 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||