DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and fz3

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster


Alignment Length:163 Identity:36/163 - (22%)
Similarity:51/163 - (31%) Gaps:56/163 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 DLDSYEA------------LVDVRCYELVSLFLCTLFVPKCGQS-GATVPPCKTLCTETMRRCGF 865
            |.|.|::            |::..|.......||:...|.|... ...|..||.|| ||:|  |.
  Fly   126 DDDDYKSDDEKGQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLC-ETVR--GE 187

  Fly   866 FFDVFGLSL----PEYLNCKLFKDFPSSEDCV----------------------GLDEVREVMR- 903
            ..:.....|    |.:|||.........|.|:                      |:::..:..| 
  Fly   188 CMENAPPELMELWPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSPGVEDHPQTYRF 252

  Fly   904 --AATHPKCD--GFQCDQN---------RCLPQ 923
              :...|..|  |..|.||         .|:||
  Fly   253 WKSGASPTSDLAGVLCPQNFSGSPFNPEECVPQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 25/118 (21%)
LDLa 911..942 CDD:238060 8/24 (33%)
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 22/88 (25%)
Frizzled 291..584 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.