DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and Prss22

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:295 Identity:99/295 - (33%)
Similarity:153/295 - (51%) Gaps:47/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1063 STLMQEFANCKKTEDYPMADLTCSNYECGRVKRGRHKPSR--RIIGGTQASPGNWPFLAAILGGP 1125
            ||.....||.:.:.|            ||       ||.:  |::||..::...||::.:||...
  Rat    26 STATVSAANIRGSPD------------CG-------KPQQLNRVVGGEDSADAQWPWIVSILKNG 71

  Fly  1126 EKIFYCAGVLISDQWVLTASHCVGN-------YSVIDLEDWTIQLGVTRRNSFTYSGQKVKVKAV 1183
            .  .:|||.|::::||::|:||..:       |||:        ||..:..:.....|||.:.:|
  Rat    72 S--HHCAGSLLTNRWVVSAAHCFSSNMDKPSPYSVL--------LGAWKLGNPGPRSQKVGIASV 126

  Fly  1184 IPHPQYNMAIAHDNDIALFQLATRVAFHEHLLPVCLPPPSVRNLHPGTLCTVIGWGKREDKDPKS 1248
            :|||:|:.......||||.:|...:.|.|.:||:|||..|| :|.|.|.|.:.|||..:|..|..
  Rat   127 LPHPRYSRKEGTHADIALVRLERPIQFSERILPICLPDSSV-HLPPNTNCWIAGWGSIQDGVPLP 190

  Fly  1249 TYEYIVNEVQVPIITRNQCDE--W--LDNLTVSEGMVCAGFDDGGKDACQGDSGGPLLCPYPGEK 1309
            ..: .:.:::||||....|..  |  .....::|.|:|||:.:|.:|||.|||||||:|..   .
  Rat   191 RPQ-TLQKLKVPIIDPELCKSLYWRGAGQEAITEDMLCAGYLEGKRDACLGDSGGPLMCQV---D 251

  Fly  1310 NRWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWIQ 1344
            :.|.:.||:|||..||....||||.:::.:.||:|
  Rat   252 DHWLLTGIISWGEGCAERNRPGVYTSLLAHRPWVQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931 5/22 (23%)
Tryp_SPc 1103..1343 CDD:214473 88/250 (35%)
Tryp_SPc 1104..1346 CDD:238113 89/252 (35%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 88/250 (35%)
Tryp_SPc 50..288 CDD:238113 89/252 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.