Sequence 1: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571102.2 | Gene: | smo / 30225 | ZFINID: | ZDB-GENE-980526-89 | Length: | 822 | Species: | Danio rerio |
Alignment Length: | 231 | Identity: | 50/231 - (21%) |
---|---|---|---|
Similarity: | 85/231 - (36%) | Gaps: | 57/231 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 728 LINAFALLAIAGGLAAYFNAYPTIKFVNKTIINTIHVEDTTSFGKNPAPGTCLPIIVRFCQGPQI 792
Fly 793 PYNYT--VFPNYIGHFGQLETQTDLDSYEALV-------DVRCYELVSLFLCTLFVPKCGQSGAT 848
Fly 849 VPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVREVMRAATHPKCD-- 911
Fly 912 -----------------GFQCDQNRCLPQEYVCDGH 930 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | 29/124 (23%) |
LDLa | 911..942 | CDD:238060 | 7/39 (18%) | ||
LDLa | 945..979 | CDD:238060 | |||
SR | 980..>1034 | CDD:214555 | |||
SRCR | 992..1086 | CDD:278931 | |||
Tryp_SPc | 1103..1343 | CDD:214473 | |||
Tryp_SPc | 1104..1346 | CDD:238113 | |||
smo | NP_571102.2 | CRD_SMO | 44..175 | CDD:143560 | 33/156 (21%) |
Frizzled | 200..528 | CDD:279827 | 2/11 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |