Sequence 1: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001124008.1 | Gene: | Fzd6 / 282581 | RGDID: | 628816 | Length: | 710 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 57/196 - (29%) |
---|---|---|---|
Similarity: | 83/196 - (42%) | Gaps: | 30/196 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 778 TCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC 842
Fly 843 GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGL--DEVREVM--- 902
Fly 903 -RAATHPKCDGFQC--------DQ-------NRCLPQEYVCDGHLDCMDQADEAKCERCGPDEIY 951
Fly 952 C 952 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | 38/115 (33%) |
LDLa | 911..942 | CDD:238060 | 11/45 (24%) | ||
LDLa | 945..979 | CDD:238060 | 3/8 (38%) | ||
SR | 980..>1034 | CDD:214555 | |||
SRCR | 992..1086 | CDD:278931 | |||
Tryp_SPc | 1103..1343 | CDD:214473 | |||
Tryp_SPc | 1104..1346 | CDD:238113 | |||
Fzd6 | NP_001124008.1 | CRD_FZ6 | 20..146 | CDD:143559 | 41/127 (32%) |
7tmF_FZD6 | 188..508 | CDD:320160 | 7/23 (30%) | ||
TM helix 1 | 198..222 | CDD:320160 | 5/13 (38%) | ||
TM helix 2 | 231..252 | CDD:320160 | |||
TM helix 3 | 283..305 | CDD:320160 | |||
TM helix 4 | 326..342 | CDD:320160 | |||
TM helix 5 | 364..387 | CDD:320160 | |||
TM helix 6 | 418..440 | CDD:320160 | |||
TM helix 7 | 469..494 | CDD:320160 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |