DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and PAMR1

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_056245.2 Gene:PAMR1 / 25891 HGNCID:24554 Length:737 Species:Homo sapiens


Alignment Length:560 Identity:125/560 - (22%)
Similarity:204/560 - (36%) Gaps:173/560 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   911 DGFQ--------CDQNRCLPQEYVCDGHLDC-MDQADEAKCERCGPDEIYCGDSQCIG--TKHIC 964
            |||.        |..:.|..     ||  .| :|:|...||             .|:.  |...|
Human   227 DGFHAIYEEITACSSSPCFH-----DG--TCVLDKAGSYKC-------------ACLAGYTGQRC 271

  Fly   965 DGIIDCPYGQ-----------DERNCLRLSERNGDV--------GTGVL--EVYRIG-------- 1000
            :.:::....:           :||||   |:..|.|        |.|::  ...:||        
Human   272 ENLLEAGKSKIKASEDSLSVLEERNC---SDPGGPVNGYQKITGGPGLINGRHAKIGTVVSFFCN 333

  Fly  1001 ---------------QRQW---MPACVKNWDRAVSPSAVCSILGYSAVNATSVLTQLTHRPLL-- 1045
                           ..:|   .|.|:|          .|         ....::.|..|.:|  
Human   334 NSYVLSGNEKRTCQQNGEWSGKQPICIK----------AC---------REPKISDLVRRRVLPM 379

  Fly  1046 ATVNVSTDIWKMYAKRKSTLMQEFANCKKTEDYPMADL--------TCSNYEC--------GRVK 1094
            ...:..|.:.::|:...|....:.|..||.. .|..||        |...|||        |..:
Human   380 QVQSRETPLHQLYSAAFSKQKLQSAPTKKPA-LPFGDLPMGYQHLHTQLQYECISPFYRRLGSSR 443

  Fly  1095 R---------GRHKPSRRIIGGTQ--ASPG----NWPFLAAIL--------GGPEK---IFYCAG 1133
            |         ||......|.|..:  .:|.    .||:.|||.        |...|   ...|:|
Human   444 RTCLRTGKWSGRAPSCIPICGKIENITAPKTQGLRWPWQAAIYRRTSGVHDGSLHKGAWFLVCSG 508

  Fly  1134 VLISDQWVLTASHCV---GNYSVIDLEDWTIQLGVTRRNS--FTYSGQKVKVKAVIPHPQYNMAI 1193
            .|::::.|:.|:|||   |..::|...|..:.||...|:.  ...:.|.:::.|:|.||.|: .|
Human   509 ALVNERTVVVAAHCVTDLGKVTMIKTADLKVVLGKFYRDDDRDEKTIQSLQISAIILHPNYD-PI 572

  Fly  1194 AHDNDIALFQLATRVAFHEHLLPVCLP-----PPSVRNLHPGTLCTVIGWGKRED-KDPKSTYEY 1252
            ..|.|||:.:|..:......:.|:||.     ..|.:..|    .||.||....| :.|....:.
Human   573 LLDADIAILKLLDKARISTRVQPICLAASRDLSTSFQESH----ITVAGWNVLADVRSPGFKNDT 633

  Fly  1253 IVNEVQVPIITRNQCDEWLDN----LTVSEGMVCAGFD-DGGKDACQGDSGGPLLCPYPGEKN-- 1310
            :.:.| |.::....|:|..::    ::|::.|.||.:: ....|.|..::||.....:||..:  
Human   634 LRSGV-VSVVDSLLCEEQHEDHGIPVSVTDNMFCASWEPTAPSDICTAETGGIAAVSFPGRASPE 697

  Fly  1311 -RWFVGGIVSWGI--MCAHPRLPGVYANVVQYVPWIQEQI 1347
             ||.:.|:|||..  .|:| ||...:..|:.:..||:..:
Human   698 PRWHLMGLVSWSYDKTCSH-RLSTAFTKVLPFKDWIERNM 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060 10/39 (26%)
LDLa 945..979 CDD:238060 5/46 (11%)
SR 980..>1034 CDD:214555 12/89 (13%)
SRCR 992..1086 CDD:278931 21/131 (16%)
Tryp_SPc 1103..1343 CDD:214473 72/277 (26%)
Tryp_SPc 1104..1346 CDD:238113 74/279 (27%)
PAMR1NP_056245.2 CUB 128..234 CDD:238001 3/6 (50%)
EGF_CA 240..272 CDD:238011 10/51 (20%)
CCP 297..360 CDD:153056 10/65 (15%)
CCP <425..460 CDD:153056 8/34 (24%)
Tryp_SPc 478..735 CDD:238113 71/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.