Sequence 1: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001457.1 | Gene: | FZD2 / 2535 | HGNCID: | 4040 | Length: | 565 | Species: | Homo sapiens |
Alignment Length: | 209 | Identity: | 56/209 - (26%) |
---|---|---|---|
Similarity: | 81/209 - (38%) | Gaps: | 45/209 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 774 PAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLF 838
Fly 839 VPKCGQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVRE--- 900
Fly 901 ---------------------------VMRAAT--HPKCDGFQCDQNRCLPQ--EYVCDGHLDCM 934
Fly 935 DQADEAKCERCGPD 948 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | 35/115 (30%) |
LDLa | 911..942 | CDD:238060 | 8/32 (25%) | ||
LDLa | 945..979 | CDD:238060 | 2/4 (50%) | ||
SR | 980..>1034 | CDD:214555 | |||
SRCR | 992..1086 | CDD:278931 | |||
Tryp_SPc | 1103..1343 | CDD:214473 | |||
Tryp_SPc | 1104..1346 | CDD:238113 | |||
FZD2 | NP_001457.1 | CRD_FZ2 | 35..161 | CDD:143573 | 38/127 (30%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 160..189 | 0/28 (0%) | |||
7tmF_FZD2 | 234..563 | CDD:320373 | |||
TM helix 1 | 244..268 | CDD:320373 | |||
TM helix 2 | 277..298 | CDD:320373 | |||
TM helix 3 | 328..350 | CDD:320373 | |||
TM helix 4 | 371..387 | CDD:320373 | |||
TM helix 5 | 409..432 | CDD:320373 | |||
TM helix 6 | 463..485 | CDD:320373 | |||
TM helix 7 | 514..539 | CDD:320373 | |||
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 543..548 | ||||
PDZ-binding | 563..565 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |