DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and Sfrp4

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_057896.1 Gene:Sfrp4 / 20379 MGIID:892010 Length:351 Species:Mus musculus


Alignment Length:201 Identity:47/201 - (23%)
Similarity:74/201 - (36%) Gaps:53/201 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   769 SFGKNPAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLF 833
            :.|...||  |..:.:..|:  .:|:|.|..||::.|..|......::.||.||||.|..::..|
Mouse    16 ALGVRGAP--CEAVRIPMCR--HMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFF 76

  Fly   834 LCTLFVPKCGQSGATVP--PCKTLCTETMRRCGFFFDVFGLSLPEYLNC---------------K 881
            ||.::.|.|.......|  |||::|......|.....::..|.||.|.|               .
Mouse    77 LCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEA 141

  Fly   882 LFKDFPSSEDCVGLDEVREVMRAATHPKCDGFQCDQNRCLPQEYVCDGHLDCMDQADEAKCERCG 946
            :..|.|  ||...:|...::|                              ..:::.:|.|:|..
Mouse   142 IVTDLP--EDVKWIDITPDMM------------------------------VQERSFDADCKRLS 174

  Fly   947 PDEIYC 952
            ||...|
Mouse   175 PDRCKC 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 36/132 (27%)
LDLa 911..942 CDD:238060 1/30 (3%)
LDLa 945..979 CDD:238060 3/8 (38%)
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Sfrp4NP_057896.1 CRD_FZ 20..146 CDD:295308 34/129 (26%)
NTR_like 188..296 CDD:295338
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.