DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and Frzb

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_035486.1 Gene:Frzb / 20378 MGIID:892032 Length:323 Species:Mus musculus


Alignment Length:290 Identity:65/290 - (22%)
Similarity:108/290 - (37%) Gaps:79/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   776 PG----TCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCT 836
            ||    .|.|:.:..|:  .:|:|.|..||::.|..|......::.:|.|:...|...:..|||.
Mouse    28 PGAQAAACEPVRIPLCK--SLPWNMTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCA 90

  Fly   837 LFVPKC--GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFP--------SSED 891
            ::.|.|  ......:.|||::|....:.|......:..|.||.|.|   .:.|        |.|.
Mouse    91 MYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPESLAC---DELPVYDRGVCISPEA 152

  Fly   892 CVGLDEVREVMRAAT-HPKCDGFQCDQNRCLP-----QEYVCDGHLDCMDQADEAKCERCGPDEI 950
            .|..|.....|.::| |  |.|...::.:|.|     :.|..:.:    :....||.:..   ::
Mouse   153 IVTADGADFPMDSSTGH--CRGASSERCKCKPVRATQKTYFRNNY----NYVIRAKVKEV---KM 208

  Fly   951 YCGD-SQCIGTKHI-----------------CDGIIDCP------------YGQDERNCLRLSER 985
            .|.| :..:..|.|                 ..|.: ||            |..:||:.|.|.|.
Mouse   209 KCHDVTAVVEVKEILKASLVNIPRDTVNLYTTSGCL-CPPLTVNEEYVIMGYEDEERSRLLLVEG 272

  Fly   986 NGDVGTGVLEVY--RIGQRQWMPACVKNWD 1013
            :      :.|.:  |:|::      ||.||
Mouse   273 S------IAEKWKDRLGKK------VKRWD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 31/125 (25%)
LDLa 911..942 CDD:238060 5/35 (14%)
LDLa 945..979 CDD:238060 10/63 (16%)
SR 980..>1034 CDD:214555 10/36 (28%)
SRCR 992..1086 CDD:278931 7/24 (29%)
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
FrzbNP_035486.1 CRD_SFRP3 32..157 CDD:143550 32/129 (25%)
NTR_Sfrp3_like 188..297 CDD:239636 23/123 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.