DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and sfrp-1

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_500977.2 Gene:sfrp-1 / 177401 WormBaseID:WBGene00022242 Length:314 Species:Caenorhabditis elegans


Alignment Length:298 Identity:67/298 - (22%)
Similarity:111/298 - (37%) Gaps:55/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 YPTIKFVNKTIINTIHVEDTTSF--GKNPAPGTC--LPIIVRFCQGPQIPYNYTVFPNYIGHFGQ 808
            :|.:..:....:...::||:.:.  .:.|....|  :|..:..|.|  |.|.....||.:.|...
 Worm     4 FPVLYILFAFSVTNGYLEDSWAMFSSERPVGPKCVDIPSNLSICNG--IEYTQMRLPNILEHETV 66

  Fly   809 LETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC-GQSGATVPPCKTLCTETMRRCGFFFDVFGL 872
            .|.......:|:|:.:.|:.....|||:||.|.| .|....:.|||:||....:.|......:|.
 Worm    67 SEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCLMQMDRLILPCKSLCMAVKQGCENRMANYGF 131

  Fly   873 SLPEYLNCKLFKDFPSSEDCVGLDEVREVMRAATHPKCDGFQCDQNRC--------LPQEYVCDG 929
            ..||.|:|:.|:|   .:.|:      :.|:.|..|......|  ..|        |..:: |..
 Worm   132 PWPEMLSCEKFED---DDMCI------KPMQPAKPPAGSSTTC--TACSQVATYENLVDQF-CRS 184

  Fly   930 HLDCMDQADEAKCERCGPDEIYCGDSQCI-------GTKHI-------CDGIIDC--PYGQDERN 978
            ||     ..:||..|..|..|...:.:.:       |...:       .||...|  |.......
 Worm   185 HL-----VLKAKVIRDSPTHIRVRNGRSLKKGERRRGVSDVEIRLSSESDGSCPCNIPVKNQNEK 244

  Fly   979 CLRLSERNGDVGTGVLEVYRIGQRQWMPACVKNWDRAV 1016
            .|.::.|..| |..:..:....|::      ||:.||:
 Worm   245 LLVMASRQPD-GKYLANLVLPWQKE------KNFKRAI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 35/118 (30%)
LDLa 911..942 CDD:238060 7/38 (18%)
LDLa 945..979 CDD:238060 7/49 (14%)
SR 980..>1034 CDD:214555 9/37 (24%)
SRCR 992..1086 CDD:278931 5/25 (20%)
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
sfrp-1NP_500977.2 CRD_FZ 37..161 CDD:382974 38/134 (28%)
NTR_Sfrp1_like 162..283 CDD:239635 25/129 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.