DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Corin and mom-5

DIOPT Version :9

Sequence 1:	NP_610297.2	Gene:	Corin / 35691	FlyBaseID:	FBgn0033192	Length:	1397	Species:	Drosophila melanogaster
Sequence 2:	NP_001300437.1	Gene:	mom-5 / 172856	WormBaseID:	WBGene00003397	Length:	570	Species:	Caenorhabditis elegans

Alignment Length:	141	Identity:	44/141 - (31%)
Similarity:	67/141 - (47%)	Gaps:	13/141 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   754 VNKTIINTIHVEDTTSFGKNPAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSY 818
            ::.|.|::::...||.        .|..|.:..|:  .:.||.|||||.:||..|.|....:..:
Worm    20 LSSTSISSMNGFSTTR--------KCEHITIPMCK--NLDYNQTVFPNLLGHTTQSEAGPAIAQF 74

  Fly   819 EALVDVRCYELVSLFLCTLFVPKCGQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLF 883
            ..|:.|:|.|.:.|||||::.|.|......:.||:.||......|......||...|:.|:|
Worm    75 NPLIKVKCSEDIRLFLCTVYAPVCTVLEKPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDC--- 136

  Fly   884 KDFPSSEDCVG 894
            ..||.::.|||
Worm   137 NKFPVTDLCVG 147

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Corin	NP_610297.2	CRD_FZ	778..894	CDD:143549	38/115 (33%)
		LDLa	911..942	CDD:238060
		LDLa	945..979	CDD:238060
		SR	980..>1034	CDD:214555
		SRCR	992..1086	CDD:278931
		Tryp_SPc	1103..1343	CDD:214473
		Tryp_SPc	1104..1346	CDD:238113
mom-5	NP_001300437.1	CRD_FZ1_like	35..147	CDD:143567	38/124 (31%)
		7tmF_Frizzled_SMO	219..550	CDD:320089
		TM helix 1	228..253	CDD:320089
		TM helix 2	262..282	CDD:320089
		TM helix 3	312..338	CDD:320089
		TM helix 4	355..371	CDD:320089
		TM helix 5	393..422	CDD:320089
		TM helix 6	446..473	CDD:320089
		TM helix 7	512..537	CDD:320089
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3577
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810