DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and mig-1

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001021744.1 Gene:mig-1 / 171677 WormBaseID:WBGene00003238 Length:529 Species:Caenorhabditis elegans


Alignment Length:239 Identity:57/239 - (23%)
Similarity:97/239 - (40%) Gaps:44/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 CLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKCG 843
            |..:....|.  .:|||.|.|||.:......:....:.:|:.|:.|.|.|.:..|||:::.|.|.
 Worm    26 CQKVDHEMCN--DLPYNLTSFPNLVDEESWKDASESILTYKPLLSVVCSEQLKFFLCSVYFPMCN 88

  Fly   844 QSGAT-VPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVREVMRAATH 907
            :..|. :.||:.||.....:|....:.||...|:.:.|..|.          |:..||.|.....
 Worm    89 EKLANPIGPCRPLCLSVQEKCLPVLESFGFKWPDVIRCDKFP----------LENNREKMCMKGP 143

  Fly   908 PKCDGFQCDQNRCLPQEYVCDGHLDCMDQADEAKCE------RCGPDEIYCG-DSQCIGTKHICD 965
            .:....|.::.:...:|...||:    |:.::.:.|      :|..||::.. .|:|:   .:|.
 Worm   144 NEQGAIQDERAKFAAKESEDDGN----DRVEDIQREVDRLNGKCPQDEVFLNRSSKCV---PLCS 201

  Fly   966 GIIDCP--YGQDERNC-------LRLSERNGDVGTGVLEVYRIG 1000
            .    |  .||.:|..       |.||    .|...:|.|:.:|
 Worm   202 N----PQKVGQTDRESATRLLLFLSLS----SVILTILSVFIVG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 30/115 (26%)
LDLa 911..942 CDD:238060 5/30 (17%)
LDLa 945..979 CDD:238060 10/36 (28%)
SR 980..>1034 CDD:214555 7/21 (33%)
SRCR 992..1086 CDD:278931 3/9 (33%)
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
mig-1NP_001021744.1 CRD_FZ 23..148 CDD:295308 34/133 (26%)
7tm_4 257..>328 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.