DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Corin and Fzd8

DIOPT Version :9

Sequence 1:	NP_610297.2	Gene:	Corin / 35691	FlyBaseID:	FBgn0033192	Length:	1397	Species:	Drosophila melanogaster
Sequence 2:	NP_032084.2	Gene:	Fzd8 / 14370	MGIID:	108460	Length:	685	Species:	Mus musculus

Alignment Length:	132	Identity:	37/132 - (28%)
Similarity:	63/132 - (47%)	Gaps:	5/132 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   779 CLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKCG 843
            |..|.|..|:|  |.||||..||...|..|.|...::..:..||:::|...:..|||:::.|.|.
Mouse    35 CQEITVPLCKG--IGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICL 97

  Fly   844 QS-GATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVR-EVMRAAT 906
            :. ...:|||:::|......|......:|.:.|:.:.|....: ..:.|.:.:|..| ::..||.
Mouse    98 EDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPE-QGNPDTLCMDYNRTDLTTAAP 161

  Fly   907 HP 908
            .|
Mouse   162 SP 163

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Corin	NP_610297.2	CRD_FZ	778..894	CDD:143549	32/115 (28%)
		LDLa	911..942	CDD:238060
		LDLa	945..979	CDD:238060
		SR	980..>1034	CDD:214555
		SRCR	992..1086	CDD:278931
		Tryp_SPc	1103..1343	CDD:214473
		Tryp_SPc	1104..1346	CDD:238113
Fzd8	NP_032084.2	CRD_FZ8	31..155	CDD:143570	34/122 (28%)
		Palmitate-binding groove	71..78		2/6 (33%)
		Wnt-binding	95..100		1/4 (25%)
		Wnt-binding	147..152		1/4 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	155..223		3/9 (33%)
		7tmF_FZD8	264..616	CDD:320378
		TM helix 1	273..298	CDD:320378
		TM helix 2	307..328	CDD:320378
		TM helix 3	395..417	CDD:320378
		TM helix 4	438..454	CDD:320378
		TM helix 5	476..499	CDD:320378
		TM helix 6	529..554	CDD:320378
		TM helix 7	577..602	CDD:320378
		Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250	606..611
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	631..656
		PDZ-binding	683..685
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3577
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900