| Sequence 1: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001155966.1 | Gene: | Fzd6 / 14368 | MGIID: | 108474 | Length: | 709 | Species: | Mus musculus |
| Alignment Length: | 196 | Identity: | 56/196 - (28%) |
|---|---|---|---|
| Similarity: | 79/196 - (40%) | Gaps: | 30/196 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 778 TCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC 842
Fly 843 GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVREVMRAATH 907
Fly 908 PKCD------GFQC--------DQ-------NRCLPQEYVCDGHLDCMDQADEAKCERCGPDEIY 951
Fly 952 C 952 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | 38/115 (33%) |
| LDLa | 911..942 | CDD:238060 | 12/51 (24%) | ||
| LDLa | 945..979 | CDD:238060 | 3/8 (38%) | ||
| SR | 980..>1034 | CDD:214555 | |||
| SRCR | 992..1086 | CDD:278931 | |||
| Tryp_SPc | 1103..1343 | CDD:214473 | |||
| Tryp_SPc | 1104..1346 | CDD:238113 | |||
| Fzd6 | NP_001155966.1 | CRD_FZ6 | 20..146 | CDD:143559 | 39/127 (31%) |
| 7tmF_FZD6 | 188..508 | CDD:320160 | 7/23 (30%) | ||
| TM helix 1 | 198..222 | CDD:320160 | 5/13 (38%) | ||
| TM helix 2 | 231..252 | CDD:320160 | |||
| TM helix 3 | 283..305 | CDD:320160 | |||
| TM helix 4 | 326..342 | CDD:320160 | |||
| TM helix 5 | 364..387 | CDD:320160 | |||
| TM helix 6 | 418..440 | CDD:320160 | |||
| TM helix 7 | 469..494 | CDD:320160 | |||
| Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 498..503 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 583..709 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||