DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and Fzd4

DIOPT Version :10

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_032081.3 Gene:Fzd4 / 14366 MGIID:108520 Length:537 Species:Mus musculus


Alignment Length:191 Identity:53/191 - (27%)
Similarity:80/191 - (41%) Gaps:26/191 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   767 TTSFGKNPAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVS 831
            |..|| :.....|.||.:..||  .:.||.|..||.:||..|.:.:..|.::..|:...|...:.
Mouse    34 TLGFG-DEEERRCDPIRIAMCQ--NLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQ 95

  Fly   832 LFLCTLFVPKCGQS-GATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSED---- 891
            .|||:::||.|.:. ...:.||..:|....|||......||.:.|:.|||   ..||...|    
Mouse    96 FFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLREFGFAWPDTLNC---SKFPPQNDHNHM 157

  Fly   892 CV---GLDEVREVMRAATHPKCDGFQCDQNRCLPQEYV-CDGHLDCMDQADEAKCERCGPD 948
            |:   |.:||....:....|   |.:|........:|: ....|:|:        .:||.|
Mouse   158 CMEGPGDEEVPLPHKTPIQP---GEECHSVGSNSDQYIWVKRSLNCV--------LKCGYD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 38/123 (31%)
LDLa 911..942 CDD:238060 5/31 (16%)
LDLa 945..979 CDD:238060 3/4 (75%)
SR 980..>1034 CDD:214555
Tryp_SPc 1104..1346 CDD:238113
Fzd4NP_032081.3 CRD_FZ4 42..167 CDD:143557 39/129 (30%)
7tmF_FZD4 209..509 CDD:320166
TM helix 1 218..243 CDD:320166
TM helix 2 252..273 CDD:320166
TM helix 3 303..329 CDD:320166
TM helix 4 346..362 CDD:320166
TM helix 5 384..413 CDD:320166
TM helix 6 433..460 CDD:320166
TM helix 7 470..495 CDD:320166
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 499..504
PDZ-binding 535..537
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.