DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and Cela2a

DIOPT Version :10

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_031945.1 Gene:Cela2a / 13706 MGIID:95316 Length:271 Species:Mus musculus


Alignment Length:101 Identity:25/101 - (24%)
Similarity:37/101 - (36%) Gaps:31/101 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 GGSDGKKPPN----NPLEKTNRLWGGVINDIKRR-----YPMYKSDIMDGLNTEALAAT------ 451
            ||.|.....|    |.||    :|..|.....|.     .|:.|..|..|:..|.|.:.      
Mouse    36 GGRDAAHLVNMDDPNKLE----IWNLVFIQFNRESETVLKPLSKKSIDTGMGLERLVSVLQNKMS 96

  Fly   452 -----IFM-YFAAL-----STAITFGGLCSDKTDNL 476
                 :|: ||.|:     :.|.| |.:.::.||.:
Mouse    97 NYDTDLFVPYFEAIQKGTGARAYT-GKVGAEDTDGI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
Tryp_SPc 1104..1346 CDD:238113
Cela2aNP_031945.1 Tryp_SPc 31..267 CDD:238113 25/101 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.