DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and fz2

DIOPT Version :10

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:XP_061518617.1 Gene:fz2 / 1272596 VectorBaseID:AGAMI1_002571 Length:687 Species:Anopheles gambiae


Alignment Length:148 Identity:39/148 - (26%)
Similarity:65/148 - (43%) Gaps:18/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   771 GKNPAP----------GTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVR 825
            |.:|.|          ..|..|.:..|:|  |.||.|.|||.:.|..|.|...::..:..||:::
Mosquito    48 GVSPMPHVPAVPKDPNSRCEEITIPMCRG--IGYNLTSFPNEMNHETQEEAGLEVHQFWPLVEIK 110

  Fly   826 CYELVSLFLCTLFVPKCGQS-GATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSS 889
            |...:..|||:::.|.|.:. ...:|.|:::|......|....:.:..:.||.:.|   ::.|.|
Mosquito   111 CSPDLKFFLCSMYTPICIEDYHKPLPVCRSVCERARAGCAPIMESYSFNWPERMAC---ENLPVS 172

  Fly   890 EDCVGLDEVREVMRAATH 907
            .|...|  ..|:.|...|
Mosquito   173 GDSDNL--CMEMPREEEH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 32/116 (28%)
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
Tryp_SPc 1104..1346 CDD:238113
fz2XP_061518617.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.