DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and fzd6

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001238809.2 Gene:fzd6 / 100490861 XenbaseID:XB-GENE-478813 Length:724 Species:Xenopus tropicalis


Alignment Length:175 Identity:51/175 - (29%)
Similarity:79/175 - (45%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   778 TCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC 842
            ||.||.|..|.|  :.||.|.|||.:.|:.|......::.:..|:::.|...|..|||..|||:|
 Frog    42 TCEPITVPRCTG--MNYNMTFFPNLLEHYDQDIAALRMEPFLPLLNLHCSPEVHTFLCRAFVPEC 104

  Fly   843 GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSED--CVGLDEVREVMRAA 905
            .:......||::||......|....:.||::.|..|.|...:|..:|:.  ..|.|:..:.:|  
 Frog   105 TEPKHITMPCRSLCERVYSDCKNLIETFGITWPAELECDRMRDCNNSQSKGGGGPDDPHDALR-- 167

  Fly   906 THPKCDGFQCDQNRCLPQEYVCDGHLDCMDQADEAK---CERCGP 947
             ||:    |..::    .::.|..||. ..|....|   .:||.|
 Frog   168 -HPE----QVHRD----FKFWCPQHLK-TSQGSGFKFLGVDRCAP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 37/117 (32%)
LDLa 911..942 CDD:238060 6/33 (18%)
LDLa 945..979 CDD:238060 2/3 (67%)
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
fzd6NP_001238809.2 CRD_FZ6 39..172 CDD:143559 42/138 (30%)
7tmF_FZD6 207..527 CDD:320160
TM helix 1 217..241 CDD:320160
TM helix 2 250..271 CDD:320160
TM helix 3 302..324 CDD:320160
TM helix 4 345..361 CDD:320160
TM helix 5 383..406 CDD:320160
TM helix 6 437..459 CDD:320160
TM helix 7 488..513 CDD:320160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.