DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and tmprss6

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:439 Identity:144/439 - (32%)
Similarity:196/439 - (44%) Gaps:87/439 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   910 CDG-FQCDQN-RCLPQEYVCDGHLDCMDQADEAKCERCGPDEIYC-GDSQCIGTKHICDGIIDCP 971
            |.| |.|..| .|:|   :|||..||.::.||..|. | |.:.:| |...||....:|||..||.
 Frog   447 CPGEFLCAVNGLCVP---LCDGVKDCPNELDERNCV-C-PAQYHCPGAESCISITSVCDGKKDCA 506

  Fly   972 YGQDERNCLRLSERNGDVGTGVLEVYRIGQRQWMPACVKNWDRAVSPSAVCSILGYSAVNATSVL 1036
            .|.||..|     ..|                           |..|:|.|....|...:.:.| 
 Frog   507 NGTDEELC-----NQG---------------------------ANFPTAACGAFNYKCADGSCV- 538

  Fly  1037 TQLTHRPLLATVNVSTDIWKMYAKRKSTLMQEFANCKKTEDYPMADLTCSNYECGRVKRGRHKPS 1101
                .:|     |...|              ..|:|....|.       :|..||....|     
 Frog   539 ----QKP-----NAECD--------------SIADCPDGSDE-------NNCGCGIQAVG----- 568

  Fly  1102 RRIIGGTQASPGNWPFLAAILGGPEKIFYCAGVLISDQWVLTASHCVGNYSVIDLEDWTIQLGVT 1166
            .|::|||||..|.||:.|::....|.|  |.|.|::|||:|||:||....|....|.||:.||..
 Frog   569 IRLVGGTQAQEGEWPWQASLQVRGEHI--CGGTLVADQWILTAAHCFTPESYASPEVWTVYLGKV 631

  Fly  1167 RRNSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQLATRVAF-HEHLLPVCLPPPSVRNLHPG 1230
            |.:..|......||..::.||.|: ..:||.|:||..|...|.. ..|:.|:|| |.|..:...|
 Frog   632 RLSRSTQKELAFKVIRLVIHPFYD-EDSHDYDVALVLLDHLVPLTSPHVQPICL-PSSTHHFPTG 694

  Fly  1231 TLCTVIGWGKREDKDPKSTYEYIVNEVQVPIITRNQCDEWLDNLTVSEGMVCAGFDDGGKDACQG 1295
            :.|.|.|||..::..|.|.   ::.:|.:.::.::.|.| |....:|..|:|||:.||.||||||
 Frog   695 SSCWVTGWGSVKENGPTSD---VLQKVDIQLVAQDICTE-LYRYQISPRMLCAGYRDGSKDACQG 755

  Fly  1296 DSGGPLLCPYPGEKNRWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWIQ 1344
            |||.||:|  .....|||..|:||||..|..||..|||:.:.:.|.||:
 Frog   756 DSGSPLVC--KTASGRWFQAGLVSWGAGCGIPRYFGVYSRITRLVQWIE 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060 13/32 (41%)
LDLa 945..979 CDD:238060 14/34 (41%)
SR 980..>1034 CDD:214555 6/53 (11%)
SRCR 992..1086 CDD:278931 12/93 (13%)
Tryp_SPc 1103..1343 CDD:214473 95/240 (40%)
Tryp_SPc 1104..1346 CDD:238113 96/242 (40%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060 13/32 (41%)
LDLa 480..514 CDD:238060 14/34 (41%)
LDLa 525..560 CDD:238060 9/65 (14%)
Tryp_SPc 572..804 CDD:238113 96/241 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3647
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.