DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and fzd9

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:XP_004911821.1 Gene:fzd9 / 100487936 XenbaseID:XB-GENE-478317 Length:587 Species:Xenopus tropicalis


Alignment Length:171 Identity:51/171 - (29%)
Similarity:72/171 - (42%) Gaps:27/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   722 FRLFQILINAFALLAIAGGLAAYFNAYPTIKFVNKTIINTIHVEDTTSFGKNPAPGTCLPIIVRF 786
            |||..:..:||....:|..||.....|...:                  |:.   ..|.||.:..
 Frog     2 FRLSSLFTSAFVWQLLAVTLALEMGLYDVER------------------GRE---AKCEPIQIPM 45

  Fly   787 CQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKCGQSGAT-VP 850
            |||  |.||.|..|||:||..|.|....|..:..||:..|:..:..|||:|:.|.|.:..:| :|
 Frog    46 CQG--IGYNMTRMPNYVGHESQEEAAAKLQEFAPLVEYGCHIHLRFFLCSLYAPMCTEQVSTSIP 108

  Fly   851 PCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSED 891
            .||.:|....::|....:.|....||.|:|   ...||..|
 Frog   109 ACKPMCEAARQKCAPIMESFQYVWPESLDC---DRLPSKND 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 41/115 (36%)
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
fzd9XP_004911821.1 CRD_FZ 34..159 CDD:382974 41/121 (34%)
7tmF_FZD9 216..535 CDD:320164
TM helix 1 225..250 CDD:320164
TM helix 2 259..280 CDD:320164
TM helix 3 309..335 CDD:320164
TM helix 4 352..368 CDD:320164
TM helix 5 390..420 CDD:320164
TM helix 6 439..466 CDD:320164
TM helix 7 496..521 CDD:320164
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.