DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and sfrp1

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001116878.1 Gene:sfrp1 / 100038100 XenbaseID:XB-GENE-488230 Length:311 Species:Xenopus tropicalis


Alignment Length:269 Identity:64/269 - (23%)
Similarity:97/269 - (36%) Gaps:53/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   770 FGKNPAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFL 834
            |...||....:|..:..|.|  :.||..|.||.:.|....|.:....|:..|:..:|:....:||
 Frog    47 FYSRPAQCVEIPQDMTLCHG--VGYNKMVLPNLLDHETMAEVKYQASSWVPLLSKKCHPGTQVFL 109

  Fly   835 CTLFVPKCGQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSED-CVG--LD 896
            |:||.|.|  ....|.||:.||......|......||...||.|.|   :.:|:.|| |:.  |.
 Frog   110 CSLFAPVC--LDRPVYPCRRLCESVRDACEPVMQYFGFHWPEMLRC---EQYPTEEDVCIAVHLP 169

  Fly   897 EVREVMRAATHPKCDGFQCDQNRCLPQ--EYVCDGHLDCMDQADEAKCERCGPDEIYCGDSQCIG 959
            ...:..|:.....|.  |||.......  |::|...........|.|.|.        ||.:.:.
 Frog   170 NATQAPRSRKTEVCP--QCDSEIKADSLYEHMCASEFALKVSIREVKKEN--------GDRKLLL 224

  Fly   960 TK-------------------HICDGIIDCPYGQDERNCLRLSERNGDVGTGVLEVYRIGQRQWM 1005
            .|                   ::.:| .:||       |.:|.:..|.    .|.:.|..:.|.:
 Frog   225 RKKKALKKGPIQKKDWSDLVLYLKNG-ANCP-------CHQLDQLKGQ----FLVLGRKVKSQHL 277

  Fly  1006 PACVKNWDR 1014
            ...:..||:
 Frog   278 LTAIHKWDK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 36/116 (31%)
LDLa 911..942 CDD:238060 6/32 (19%)
LDLa 945..979 CDD:238060 6/52 (12%)
SR 980..>1034 CDD:214555 7/35 (20%)
SRCR 992..1086 CDD:278931 5/23 (22%)
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
sfrp1NP_001116878.1 CRD_SFRP1 48..172 CDD:143552 39/130 (30%)
NTR_Sfrp1_like 180..303 CDD:239635 23/129 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.