DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and sfrpx

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001090810.1 Gene:sfrpx / 100037908 XenbaseID:XB-GENE-495296 Length:288 Species:Xenopus tropicalis


Alignment Length:161 Identity:44/161 - (27%)
Similarity:60/161 - (37%) Gaps:28/161 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   773 NPAPGTCLPII-----------------VRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEA 820
            |..|...||.|                 :..|.|  :.|:....||.:||....|......|:..
 Frog    13 NLCPSAALPFILTQLSTRKSSCKAIPSSMTLCHG--VGYSEMRLPNLLGHDTMKEVLQQAGSWVP 75

  Fly   821 LVDVRCYELVSLFLCTLFVPKC-GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFK 884
            |:..:|:.....|||:||.|.| .:....|.||::||......|......||...|:..||   .
 Frog    76 LLTKQCHADTKKFLCSLFAPVCLSELEEAVYPCRSLCEAVRDGCTPVMAAFGFPWPDMFNC---T 137

  Fly   885 DFP-SSEDCV----GLDEVREVMRAATHPKC 910
            .|| .:|.||    ..|:.:||...|....|
 Frog   138 QFPLGNELCVPPAGSEDKQQEVKEEAPCSAC 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 37/138 (27%)
LDLa 911..942 CDD:238060 44/161 (27%)
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
sfrpxNP_001090810.1 CRD_FZ 30..157 CDD:413323 35/131 (27%)
NTR_Sfrp1_like 162..288 CDD:239635 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.