DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1598 and AT1G26090

DIOPT Version :10

Sequence 1:NP_610296.2 Gene:CG1598 / 35690 FlyBaseID:FBgn0033191 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_173934.2 Gene:AT1G26090 / 839150 AraportID:AT1G26090 Length:455 Species:Arabidopsis thaliana


Alignment Length:30 Identity:10/30 - (33%)
Similarity:16/30 - (53%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SLKTEVPGPKSRALLQQLNQLQNANSVQMF 70
            ||.||:.|.....|::.|..|:|...:.:|
plant   136 SLGTELQGIDRTILMRALKLLENKGKLALF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1598NP_610296.2 ArsA_ATPase 21..326 CDD:396792 10/30 (33%)
AT1G26090NP_173934.2 ArsA 59..>320 CDD:349755 10/30 (33%)
ArsA_HSP20 396..454 CDD:436117
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.