| Sequence 1: | NP_610296.2 | Gene: | CG1598 / 35690 | FlyBaseID: | FBgn0033191 | Length: | 336 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_173934.2 | Gene: | AT1G26090 / 839150 | AraportID: | AT1G26090 | Length: | 455 | Species: | Arabidopsis thaliana |
| Alignment Length: | 30 | Identity: | 10/30 - (33%) |
|---|---|---|---|
| Similarity: | 16/30 - (53%) | Gaps: | 0/30 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 SLKTEVPGPKSRALLQQLNQLQNANSVQMF 70 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1598 | NP_610296.2 | ArsA_ATPase | 21..326 | CDD:396792 | 10/30 (33%) |
| AT1G26090 | NP_173934.2 | ArsA | 59..>320 | CDD:349755 | 10/30 (33%) |
| ArsA_HSP20 | 396..454 | CDD:436117 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||