DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1598 and AT5G60730

DIOPT Version :9

Sequence 1:NP_610296.2 Gene:CG1598 / 35690 FlyBaseID:FBgn0033191 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_200881.2 Gene:AT5G60730 / 836194 AraportID:AT5G60730 Length:391 Species:Arabidopsis thaliana


Alignment Length:331 Identity:110/331 - (33%)
Similarity:180/331 - (54%) Gaps:21/331 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVEQDSLKWIFVGGKGGVGKTTCSSSLAVQLSKVRESVLIISTDPAHNISDAFDQKFT-KVPTKV 78
            :|..:..|:..:|||||||||:|::||||:.:......:::||||||::||:|.|..: .|...|
plant    63 MVSVNQRKYYLLGGKGGVGKTSCAASLAVKFASHGHPTIVVSTDPAHSLSDSFSQDLSGGVLKPV 127

  Fly    79 NGFDN-LFAMEIDPNAGLNELPEEYFDGENEALRVSKGV-----------MQEMINAL-PGIDEA 130
            .|.|: |.|:||.|....:|:..:..|...:.:..|.|:           :::|:||. |||||.
plant   128 QGVDSPLLALEITPEIMKDEIKRQTGDKSVKNMMDSMGLGMFAGELGDLNLEDMLNAASPGIDEI 192

  Fly   131 MSYAEVMKLVKG---MNFSVVVFDTAPTGHTLRLIAFPQVVEKGLGKLLRLKMKVAPLLSQFVSM 192
            .:.::|::.::.   ..|:.:|||||||||||||::.|...:..:.|:.:||.|:....|.|..:
plant   193 AAISKVLQFMEAPEYSRFTRIVFDTAPTGHTLRLLSLPDFYDSSISKITKLKKKITAAASAFKLV 257

  Fly   193 LGMADVNADTLSQKLDDMLRVITQVNEQFKNPDQTTFVCVCIAEFFSLYETERLVQELTKCGIDV 257
            .|..::....|..:||.:...:.:|...|::.|.|.||.|.|....::.|:.||...|.|..:.|
plant   258 FGKKEIQQKELPNELDQLKERMEKVRNVFRDVDTTEFVIVTIPTVMAINESSRLHASLRKENVPV 322

  Fly   258 HNIIVNQLLFLQNSHDSCSMCASRFKIQEKYLDQIADLYE--DFHVTKLPLLEKEVRGPESIRSF 320
            |.:|||||  |..|...|..|:.|.|.|.:.|..|.:..|  ...:.:.|||:.|:||..:::..
plant   323 HRLIVNQL--LPQSESDCKFCSIRRKEQTRVLGLIQNDTELSGLKLIQSPLLDAEIRGVPALKFM 385

  Fly   321 SENLMK 326
            .:.:.|
plant   386 GDLIWK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1598NP_610296.2 ArsA_ATPase 21..326 CDD:280525 108/323 (33%)
ArsA 37..330 CDD:223082 99/309 (32%)
AT5G60730NP_200881.2 ArsA 83..386 CDD:349755 99/304 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0003
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60619
OrthoDB 1 1.010 - - D992208at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10803
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.