DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1598 and AT3G10350

DIOPT Version :9

Sequence 1:NP_610296.2 Gene:CG1598 / 35690 FlyBaseID:FBgn0033191 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001189855.1 Gene:AT3G10350 / 820197 AraportID:AT3G10350 Length:433 Species:Arabidopsis thaliana


Alignment Length:342 Identity:114/342 - (33%)
Similarity:180/342 - (52%) Gaps:50/342 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVEQDSLKWIFVGGKGGVGKTTCSSSLAVQLSKVRESVLIISTDPAHNISDAFDQKFT---KVPT 76
            :|.....|:..:|||||||||:|::||||:.:......|::||||||::||:|.|..|   .|| 
plant   112 MVSGTKRKYYMLGGKGGVGKTSCAASLAVRFANNGHPTLVVSTDPAHSLSDSFAQDLTGGMLVP- 175

  Fly    77 KVNGFD-NLFAMEIDPNAGLNEL-----------PEEYFDGENEALRVSKGVMQEMINAL----- 124
             |.|.: .|||:||:|.....|.           .:::.||      :..|::.|.:..|     
plant   176 -VEGPEAPLFALEINPEKAREEFRSASQMNGGTGVKDFMDG------MGLGMLVEQLGELKLGEL 233

  Fly   125 -----PGIDEAMSYAEVMKLVKGMNFSVVVFDTAPTGHTLRLIAFPQVVEKGLGKLLRLKMKVAP 184
                 ||:|||::      :.|...:|::|||||||||||||::.|..::..:||:|:|:.|:..
plant   234 LDTPPPGLDEAIA------ISKEFCYSIIVFDTAPTGHTLRLLSLPDFLDASIGKILKLRQKITS 292

  Fly   185 LLSQFVSMLGMADVNADTLSQKLDDMLRVITQVNEQFKNPDQTTFVCVCIAEFFSLYETERLVQE 249
            ..|...|:.|..:...|. :.||:.:...:.:|.|.|::.:.|.||.|.|....::.|:.||...
plant   293 ATSAIKSVFGKEEKGPDA-ADKLEKLRERMVKVRELFRDTESTEFVIVTIPTVMAVSESSRLSAS 356

  Fly   250 LTKCGIDVHNIIVNQLLFLQNSHDSCSMCASRFKIQEKYLDQIADLYEDFHVTKL-----PLLEK 309
            |.|..:.|..:|||||  |..|...|..|:.:.|.|.:.||.|.   ||..::.|     ||::.
plant   357 LKKESVPVKRLIVNQL--LPPSSSDCKFCSIKRKDQMRALDMIR---EDSELSALTLMEAPLVDM 416

  Fly   310 EVRGPESIRSFSENLMK 326
            |:||..::|...:.:.|
plant   417 EIRGVPALRFLGDIIWK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1598NP_610296.2 ArsA_ATPase 21..326 CDD:280525 112/334 (34%)
ArsA 37..330 CDD:223082 103/320 (32%)
AT3G10350NP_001189855.1 P-loop_NTPase 119..433 CDD:304359 112/333 (34%)
ArsA 119..431 CDD:223082 112/331 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0003
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60619
OrthoDB 1 1.010 - - D992208at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100709
Panther 1 1.100 - - O PTHR10803
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.