DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CYB5

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_014288.3 Gene:CYB5 / 855612 SGDID:S000005055 Length:120 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:44/120 - (36%)
Similarity:81/120 - (67%) Gaps:7/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARD 71
            |.::..|||:||..::.|::|.:.:|||:.|.:|||||:|::::..|:||||:|.|:|||::|..
Yeast     3 KVYSYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGHSDEALR 67

  Fly    72 MMKKYKIGELVE-SERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFY 125
            ::|...||::.: |||.||.:.|    ::|.|::.|.  :.:|.|.:.::...:|
Yeast    68 LLKGLYIGDVDKTSERVSVEKVS----TSENQSKGSG--TLVVILAILMLGVAYY 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 31/72 (43%)
CYB5NP_014288.3 CYB5 <1..119 CDD:227599 44/120 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I1836
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S967
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm46547
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
TreeFam 1 0.960 - -
1211.750

Return to query results.
Submit another query.