DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and IRC21

DIOPT Version :10

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_013789.1 Gene:IRC21 / 855095 SGDID:S000004677 Length:201 Species:Saccharomyces cerevisiae


Alignment Length:46 Identity:17/46 - (36%)
Similarity:28/46 - (60%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RAEVAKHNTNKD-TWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKD 55
            |..|.||...:| .|.:|:..:||::::|..||||.::||:....|
Yeast   127 RKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 10..82 CDD:459698 17/46 (37%)
IRC21NP_013789.1 Cyt-b5 130..199 CDD:459698 16/43 (37%)

Return to query results.
Submit another query.