DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CYB2

DIOPT Version :10

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_013658.1 Gene:CYB2 / 854950 SGDID:S000004518 Length:591 Species:Saccharomyces cerevisiae


Alignment Length:110 Identity:42/110 - (38%)
Similarity:58/110 - (52%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMKKY 76
            |||||||...|.|::|:..:||:|.||..||||::|:...||||.|..||.:    .|.:::.||
Yeast    94 AEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFEPL----HAPNVIDKY 154

  Fly    77 -----KIGELVESERTS-VAQKSEPTWSTEQQTEESSVKSWLVPL 115
                 |:|.|..|.... |.....|..:.|....:..:||.|.||
Yeast   155 IAPEKKLGPLQGSMPPELVCPPYAPGETKEDIARKEQLKSLLPPL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 10..82 CDD:459698 32/74 (43%)
CYB2NP_013658.1 Cyt-b5 92..164 CDD:459698 32/73 (44%)
FCB2_FMN 206..555 CDD:239238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.