DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and OLE1

DIOPT Version :10

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_011460.3 Gene:OLE1 / 852825 SGDID:S000003023 Length:510 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:28/92 - (30%)
Similarity:54/92 - (58%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFED--VGHSN 67
            :.:||    :||...||.. ::|...::||:.:::||||||.::....|||||:.|..  ..|||
Yeast   413 DKQTF----LAKSKENKGL-VIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGGVYRHSN 472

  Fly    68 DARDMMKKYKIGELVESERTSVAQKSE 94
            .|::::...::..:.||:.:::...|:
Yeast   473 AAQNVLADMRVAVIKESKNSAIRMASK 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 10..82 CDD:459698 23/73 (32%)
OLE1NP_011460.3 OLE1 111..383 CDD:441008
Cyt-b5 413..487 CDD:459698 25/78 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.