DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CB5LP

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_176265.1 Gene:CB5LP / 842360 AraportID:AT1G60660 Length:121 Species:Arabidopsis thaliana


Alignment Length:75 Identity:30/75 - (40%)
Similarity:52/75 - (69%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARD 71
            |:::::|||.||...|.|::|.:.:||:|:::.|||||:.:| :.||.|:|:.|....|:....|
plant    47 KSYSKSEVAVHNKRNDCWIIIKDKVYDITSYVEEHPGGDAIL-DHAGDDSTDGFFGPQHATRVFD 110

  Fly    72 MMKKYKIGEL 81
            |::.:.||||
plant   111 MIEDFYIGEL 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 27/72 (38%)
CB5LPNP_176265.1 Cyt-b5 50..121 CDD:395121 29/72 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.