DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CB5-A

DIOPT Version :10

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_173958.1 Gene:CB5-A / 839176 AraportID:AT1G26340 Length:135 Species:Arabidopsis thaliana


Alignment Length:128 Identity:53/128 - (41%)
Similarity:82/128 - (64%) Gaps:10/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDAR 70
            ||.::..|.|.||...|.|::|...:|||:::::|||||::||:..||||||::|||.|||.|||
plant     5 TKLYSMEEAATHNKQDDCWVVIDGKVYDVSSYMDEHPGGDDVLLAVAGKDATDDFEDAGHSKDAR 69

  Fly    71 DMMKKYKIGELVESE-----RTSVAQKSEPTWSTEQQTEESSVKSWLVPL----VLCLVATLF 124
            ::|:||.||||.||.     ...:.:|.:|..|. |:..:.:.:.|:||:    :...|:.||
plant    70 ELMEKYFIGELDESSLPEIPELKIYKKDQPQDSV-QKLFDLTKQYWVVPVSIITISVAVSVLF 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 10..82 CDD:459698 38/71 (54%)
CB5-ANP_173958.1 Cyt-b5 9..81 CDD:459698 38/71 (54%)

Return to query results.
Submit another query.