DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CB5-A

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_173958.1 Gene:CB5-A / 839176 AraportID:AT1G26340 Length:135 Species:Arabidopsis thaliana


Alignment Length:128 Identity:53/128 - (41%)
Similarity:82/128 - (64%) Gaps:10/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDAR 70
            ||.::..|.|.||...|.|::|...:|||:::::|||||::||:..||||||::|||.|||.|||
plant     5 TKLYSMEEAATHNKQDDCWVVIDGKVYDVSSYMDEHPGGDDVLLAVAGKDATDDFEDAGHSKDAR 69

  Fly    71 DMMKKYKIGELVESE-----RTSVAQKSEPTWSTEQQTEESSVKSWLVPL----VLCLVATLF 124
            ::|:||.||||.||.     ...:.:|.:|..|. |:..:.:.:.|:||:    :...|:.||
plant    70 ELMEKYFIGELDESSLPEIPELKIYKKDQPQDSV-QKLFDLTKQYWVVPVSIITISVAVSVLF 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 37/72 (51%)
CB5-ANP_173958.1 Cyt-b5 9..81 CDD:395121 38/71 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I2061
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm2927
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X609
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.