DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CB5-E

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_200168.1 Gene:CB5-E / 835438 AraportID:AT5G53560 Length:134 Species:Arabidopsis thaliana


Alignment Length:133 Identity:62/133 - (46%)
Similarity:87/133 - (65%) Gaps:11/133 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSN 67
            |.:.|..:..||:|||..||.||:|...:||||.|:::||||:|||:...|||||.:|||||||:
plant     2 SSDRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSD 66

  Fly    68 DARDMMKKYKIGEL----VESERTSVAQKSEPTWSTEQQTEESSVK--SWLVPLV---LCLVATL 123
            .|||||.||.|||:    |.:.||.||.: :|.:: :.:|.|..:|  .:|||::   |.||...
plant    67 TARDMMDKYFIGEIDSSSVPATRTYVAPQ-QPAYN-QDKTPEFIIKILQFLVPILILGLALVVRH 129

  Fly   124 FYK 126
            :.|
plant   130 YTK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 43/72 (60%)
CB5-ENP_200168.1 Cyt-b5 9..81 CDD:395121 44/71 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2318
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41475
Inparanoid 1 1.050 111 1.000 Inparanoid score I2061
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm2927
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.