DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CB5-D

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_199692.1 Gene:CB5-D / 834939 AraportID:AT5G48810 Length:140 Species:Arabidopsis thaliana


Alignment Length:124 Identity:49/124 - (39%)
Similarity:79/124 - (63%) Gaps:1/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARD 71
            |.||.:||::|::.||.|::|...:||||.||::||||:||::...|||||::|||||||:.|:.
plant     6 KVFTLSEVSQHSSAKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFEDVGHSSTAKA 70

  Fly    72 MMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFFFG 130
            |:.:|.:|: :::....|..|..|..||:....:.....:::.|:..||..|.....||
plant    71 MLDEYYVGD-IDTATVPVKAKFVPPTSTKAVATQDKSSDFVIKLLQFLVPLLILGLAFG 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 37/72 (51%)
CB5-DNP_199692.1 Cyt-b5 9..81 CDD:395121 36/72 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I2061
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm2927
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.