Sequence 1: | NP_610294.1 | Gene: | Cyt-b5 / 35688 | FlyBaseID: | FBgn0264294 | Length: | 134 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_085056.2 | Gene: | CYB5B / 80777 | HGNCID: | 24374 | Length: | 150 | Species: | Homo sapiens |
Alignment Length: | 131 | Identity: | 59/131 - (45%) |
---|---|---|---|
Similarity: | 90/131 - (68%) | Gaps: | 4/131 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 EETKTFTR-AEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSN 67
Fly 68 DARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFFFGGA 132
Fly 133 K 133 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cyt-b5 | NP_610294.1 | Cyt-b5 | 8..81 | CDD:278597 | 50/73 (68%) |
CYB5B | NP_085056.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | ||
Cyt-b5 | 28..100 | CDD:365921 | 49/71 (69%) | ||
MIP | <123..148 | CDD:350945 | 3/24 (13%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 109 | 1.000 | Domainoid score | I6354 |
eggNOG | 1 | 0.900 | - | - | E1_COG5274 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 127 | 1.000 | Inparanoid score | I4689 |
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S967 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1566561at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000784 | |
OrthoInspector | 1 | 1.000 | - | - | otm42055 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_100589 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R279 |
SonicParanoid | 1 | 1.000 | - | - | X609 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
13 | 12.710 |