DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CYB5B

DIOPT Version :10

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_085056.2 Gene:CYB5B / 80777 HGNCID:24374 Length:150 Species:Homo sapiens


Alignment Length:131 Identity:59/131 - (45%)
Similarity:90/131 - (68%) Gaps:4/131 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EETKTFTR-AEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSN 67
            |.:.|:.| .||||.|:.|:.||:||..:||||.||||||||||||:||||.||:|:|||||||:
Human    21 ETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSS 85

  Fly    68 DARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFFFGGA 132
            |||:|:|:|.||::..|:....:...:|   ::..|.:|....|::|::..::....|:::...:
Human    86 DAREMLKQYYIGDIHPSDLKPESGSKDP---SKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSES 147

  Fly   133 K 133
            |
Human   148 K 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 10..82 CDD:459698 49/72 (68%)
CYB5BNP_085056.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyt-b5 28..100 CDD:459698 49/71 (69%)
MIP <123..148 CDD:444743 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.