DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CYB5B

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_085056.2 Gene:CYB5B / 80777 HGNCID:24374 Length:150 Species:Homo sapiens


Alignment Length:131 Identity:59/131 - (45%)
Similarity:90/131 - (68%) Gaps:4/131 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EETKTFTR-AEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSN 67
            |.:.|:.| .||||.|:.|:.||:||..:||||.||||||||||||:||||.||:|:|||||||:
Human    21 ETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSS 85

  Fly    68 DARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFFFGGA 132
            |||:|:|:|.||::..|:....:...:|   ::..|.:|....|::|::..::....|:::...:
Human    86 DAREMLKQYYIGDIHPSDLKPESGSKDP---SKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSES 147

  Fly   133 K 133
            |
Human   148 K 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 50/73 (68%)
CYB5BNP_085056.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyt-b5 28..100 CDD:365921 49/71 (69%)
MIP <123..148 CDD:350945 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6354
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4689
Isobase 1 0.950 - 0 Normalized mean entropy S967
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm42055
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.710

Return to query results.
Submit another query.