DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and Cyb5b

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_085075.1 Gene:Cyb5b / 80773 RGDID:621551 Length:146 Species:Rattus norvegicus


Alignment Length:132 Identity:60/132 - (45%)
Similarity:90/132 - (68%) Gaps:4/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SEETKTFTR-AEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHS 66
            |:...|:.| .||||.||.::||::||..:||:|.||:|||||||||:||||.||||:|||||||
  Rat    16 SDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHS 80

  Fly    67 NDARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFFFGG 131
            .|||:|:|:|.||::..::........:|   ::..:.:||...|:||:|..::....|:.|:..
  Rat    81 PDAREMLKQYYIGDVHPNDLKPKDGDKDP---SKNNSCQSSWAYWIVPIVGAILIGFLYRHFWAD 142

  Fly   132 AK 133
            :|
  Rat   143 SK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 49/73 (67%)
Cyb5bNP_085075.1 Cyt-b5 22..95 CDD:278597 48/72 (67%)
MIP <109..139 CDD:294134 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6265
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm46200
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X609
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.680

Return to query results.
Submit another query.