DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and cyb5r4

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_005173509.1 Gene:cyb5r4 / 553685 ZFINID:ZDB-GENE-050522-225 Length:577 Species:Danio rerio


Alignment Length:90 Identity:32/90 - (35%)
Similarity:53/90 - (58%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMK 74
            |..|:.||||.||.|..|...:|:::|:::.||||||.|:..||.|:|:.|::|....:...|:|
Zfish   110 TEDELKKHNTKKDCWTCIRGMVYNLSAYMDFHPGGEEELMRAAGIDSTDLFDEVHRWVNYESMLK 174

  Fly    75 KYKIGELVESERTSVAQKSEPTWST 99
            :..:|.:......::...:|.|.||
Zfish   175 ECLVGRMAVKPSPALQAHTEKTEST 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 28/70 (40%)
cyb5r4XP_005173509.1 Cyt-b5 108..180 CDD:278597 27/69 (39%)
p23_NCB5OR 228..314 CDD:107240
cyt_b5_reduct_like 336..575 CDD:99780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.