DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CYB5R4

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_057314.2 Gene:CYB5R4 / 51167 HGNCID:20147 Length:521 Species:Homo sapiens


Alignment Length:105 Identity:31/105 - (29%)
Similarity:52/105 - (49%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMK 74
            |..|:.|||...|.|:.|...:|:|:.::..|||||:.|:..||.|.||.|:.|....:...|:|
Human    58 TEEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESMLK 122

  Fly    75 KYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVP 114
            :..:|.:.          .:|....:.:.||..|.:.::|
Human   123 ECLVGRMA----------IKPAVLKDYREEEKKVLNGMLP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 26/70 (37%)
CYB5R4NP_057314.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyt-b5 58..130 CDD:306642 26/71 (37%)
p23_NCB5OR 170..256 CDD:107240
cyt_b5_reduct_like 278..519 CDD:99780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.