DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CYB5R4

DIOPT Version :10

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_057314.2 Gene:CYB5R4 / 51167 HGNCID:20147 Length:521 Species:Homo sapiens


Alignment Length:105 Identity:31/105 - (29%)
Similarity:52/105 - (49%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMK 74
            |..|:.|||...|.|:.|...:|:|:.::..|||||:.|:..||.|.||.|:.|....:...|:|
Human    58 TEEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESMLK 122

  Fly    75 KYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVP 114
            :..:|.:.          .:|....:.:.||..|.:.::|
Human   123 ECLVGRMA----------IKPAVLKDYREEEKKVLNGMLP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 10..82 CDD:459698 26/71 (37%)
CYB5R4NP_057314.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyt-b5 58..130 CDD:459698 26/71 (37%)
p23_NCB5OR 170..256 CDD:107240
cyt_b5_reduct_like 278..519 CDD:99780
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.