DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and cyb5b

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001011009.2 Gene:cyb5b / 496418 XenbaseID:XB-GENE-1016087 Length:141 Species:Xenopus tropicalis


Alignment Length:128 Identity:59/128 - (46%)
Similarity:82/128 - (64%) Gaps:4/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SEETKT--FTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGH 65
            |||.:.  :|..:|.|.||.|:.||:||:.:||:|.|:.|||||||||.||||.||||:|||.||
 Frog     9 SEEPQVTLYTLEDVRKRNTAKEIWLVIHDRVYDITKFVEEHPGGEEVLFEQAGADATESFEDAGH 73

  Fly    66 SNDARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFF 128
            |.|||:|:.:|.||:|...:..:..:|.  ...|...:..||..|||:|.|..::....|:|:
 Frog    74 SIDAREMLNQYYIGDLHPDDCKNQGKKD--VLLTTSSSTSSSWSSWLIPAVAVVILGFMYRFY 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 44/74 (59%)
cyb5bNP_001011009.2 Cyt-b5 16..89 CDD:278597 44/72 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4441
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm49283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.