DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and cyb5a

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_998300.2 Gene:cyb5a / 406409 ZFINID:ZDB-GENE-040426-2148 Length:137 Species:Danio rerio


Alignment Length:122 Identity:61/122 - (50%)
Similarity:82/122 - (67%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARD 71
            |.:..:||.:.|:.|.||::|||.:||||.||.|||||||||.||||.||||:|||||||.|||:
Zfish    12 KYYRLSEVEERNSFKSTWIIIHNKVYDVTKFLEEHPGGEEVLREQAGGDATESFEDVGHSTDARE 76

  Fly    72 MMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFF 128
            |.....|||:...:|..:|:..|...:|.|:| .|...:||:|.|..::.||.|:.:
Zfish    77 MASSMLIGEVHPDDRDKIAKPPESLVTTVQET-TSWWSNWLIPAVAAVIVTLMYRIY 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 45/72 (63%)
cyb5aNP_998300.2 Cyt-b5 15..87 CDD:306642 46/71 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41475
Inparanoid 1 1.050 129 1.000 Inparanoid score I4635
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm25334
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.