DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and cyb5b

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_998041.1 Gene:cyb5b / 405812 ZFINID:ZDB-GENE-040426-2614 Length:153 Species:Danio rerio


Alignment Length:138 Identity:61/138 - (44%)
Similarity:86/138 - (62%) Gaps:22/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEE---TKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDV 63
            |::|   .|.:||.||..||..|||||:||:.:||:|:|:.|||||||||:||||.||||:||||
Zfish    20 STQEDSGVKYYTRKEVQVHNMGKDTWLIIHDKVYDITSFMEEHPGGEEVLLEQAGADATESFEDV 84

  Fly    64 GHSNDARDMMKKYKIGELVESERTS--------VAQKSEPTWSTEQQTEESSVKSWLVPLVLCLV 120
            |||.|||:|:::|.||||...:|..        ...|...:|||           |.:|.:..::
Zfish    85 GHSTDAREMLQQYYIGELHMDDRKKESKKEVYITTSKDSRSWST-----------WFIPAIAAVL 138

  Fly   121 ATLFYKFF 128
            ..:.|:::
Zfish   139 VGIMYRYY 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 48/72 (67%)
cyb5bNP_998041.1 Cyt-b5 29..102 CDD:278597 48/72 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5957
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4635
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm25334
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - O PTHR19359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.