DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and CG6870

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster


Alignment Length:111 Identity:42/111 - (37%)
Similarity:65/111 - (58%) Gaps:13/111 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSND 68
            |:.......|||:|::..|.|::|::.:||||.||.:||||::|:::.||:|||..|...|||.|
  Fly    39 EDLPEIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGD 103

  Fly    69 ARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVP 114
            |.:|||.:.||:|             ||.....:|.::.|.|..:|
  Fly   104 AIEMMKDFLIGQL-------------PTKQHIFRTGKNKVLSLGIP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 34/72 (47%)
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 34/69 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - P PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.