DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and Fa2h

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001129055.1 Gene:Fa2h / 307855 RGDID:1310347 Length:372 Species:Rattus norvegicus


Alignment Length:126 Identity:35/126 - (27%)
Similarity:63/126 - (50%) Gaps:21/126 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDV--GHSNDAR 70
            :||.|||.:.......|:....::||:|.|:..|||||::|:.:||:|.:.:.:..  .||::||
  Rat    10 SFTSAEVQRRLAAGACWVRRGASLYDLTGFVRHHPGGEQLLLARAGQDISADLDGPPHKHSDNAR 74

  Fly    71 DMMKKYKIGEL---------------VESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLV 116
            ..:::|.:|||               .|:::|..|  .||.:.....  :..:..|..||:
  Rat    75 RWLEQYYVGELRADPQDPTENGAGAPAETQKTDAA--IEPQFKVVDW--DKDLVDWQKPLL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 25/74 (34%)
Fa2hNP_001129055.1 Cyt-b5 12..86 CDD:395121 25/73 (34%)
FA_hydroxylase 124..372 CDD:412761 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.