DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and scs7

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_594423.1 Gene:scs7 / 2542519 PomBaseID:SPAC19G12.08 Length:347 Species:Schizosaccharomyces pombe


Alignment Length:98 Identity:23/98 - (23%)
Similarity:36/98 - (36%) Gaps:34/98 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMKKYKIGELVE 83
            |::...:|.....||||.:|            .|.|||.             |::::|...|:.:
pombe     5 TSEKCVILSDGTEYDVTNYL------------VANKDAA-------------DLLRRYHRQEVAD 44

  Fly    84 -SERTSVAQKSEPTWSTEQQTEESSVKSWLVPL 115
             ...||.::.||..        ...:||..|||
pombe    45 ILNATSKSKHSEAV--------VEILKSAKVPL 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 13/61 (21%)
scs7NP_594423.1 CYB5 1..184 CDD:227599 23/98 (23%)
FA_hydroxylase 108..331 CDD:294712
ERG3 <188..347 CDD:225546
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.