DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and SPBC29A10.16c

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_596061.1 Gene:SPBC29A10.16c / 2540533 PomBaseID:SPBC29A10.16c Length:124 Species:Schizosaccharomyces pombe


Alignment Length:114 Identity:35/114 - (30%)
Similarity:70/114 - (61%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARD 71
            |.|...|:.:||.:||.:::|:..:|||:.|.::||||.:::::.||:|||:.::|:|||..|.:
pombe     4 KYFEPEEIVEHNNSKDMYMVINGKVYDVSNFADDHPGGLDIMLDYAGQDATKAYQDIGHSIAADE 68

  Fly    72 MMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLV 120
            ::::..||:|.......:.:..:|. |.:..|..       :||::.|:
pombe    69 LLEEMYIGDLKPGTEERLKELKKPR-SFDNDTPP-------LPLLIALI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 27/72 (38%)
SPBC29A10.16cNP_596061.1 CYB5 <2..124 CDD:227599 35/114 (31%)
Cyt-b5 5..78 CDD:278597 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - O PTHR19359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X609
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.