DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and oca8

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_587997.1 Gene:oca8 / 2538772 PomBaseID:SPCC16A11.10c Length:129 Species:Schizosaccharomyces pombe


Alignment Length:126 Identity:49/126 - (38%)
Similarity:78/126 - (61%) Gaps:8/126 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARD 71
            ||.|..||.||||..|.::::.:.:||::.||:.||||||||::.||:||:..|||||||.||::
pombe     4 KTITVEEVLKHNTRDDLYIVVKDKVYDISKFLDAHPGGEEVLVDLAGRDASGPFEDVGHSEDAQE 68

  Fly    72 MMKKYKIGELVESE-----RTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKF 127
            :::|:.||.|:.:|     .|:.|......:.:.|..:.:   .||..||:.:....|.|:
pombe    69 LLEKFYIGNLLRTEDGPQLPTTGAAAGGSGYDSSQPVKPA---MWLFVLVMVVAYFAFRKY 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 37/72 (51%)
oca8NP_587997.1 CYB5 <2..128 CDD:227599 49/126 (39%)
Cyt-b5 5..78 CDD:278597 37/72 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2097
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1693
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - oto101928
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.